PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00448.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 236aa    MW: 25750.4 Da    PI: 6.3335
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00448.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.82.1e-372581662
                   zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                              +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rk+++++
  Rsa1.0_00448.1_g00004.1 25 PSCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKSRRTK 81
                             58***************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-212171IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.632579IPR003851Zinc finger, Dof-type
PfamPF027011.6E-312679IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MERTEALTSS FIWRPNANAN AEITPSCPRC GSSNTKFCYY NNYSLTQPRY FCKGCRRYWT  60
KGGSLRNVPV GGGCRKSRRT KSSSSNSKTG VTASSCSSGG GSPNIDLALV YANFLNPKPD  120
EPTLQEACDL ATGASMKPSW SIDIGDHHHY DHQVEHIVEE CGYNGLPPFP GEELLSIDTN  180
SVWSDALLIG HHHVEVGGVT PARTVHEPVV HFADESNDST NFLLGSWSPF DFSTDG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936461e-102AB493646.1 Arabidopsis thaliana At3g52440 gene for hypothetical protein, partial cds, clone: RAAt3g52440.
GenBankAL0503001e-102AL050300.2 Arabidopsis thaliana DNA chromosome 3, BAC clone F22O6.
GenBankCP0026861e-102CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597296.11e-148PREDICTED: dof zinc finger protein DOF3.5
RefseqXP_013705781.11e-148PREDICTED: dof zinc finger protein DOF3.5
SwissprotQ9SVC51e-145DOF35_ARATH; Dof zinc finger protein DOF3.5
TrEMBLA0A078GVE11e-148A0A078GVE1_BRANA; BnaC07g32880D protein
TrEMBLA0A0D3DE601e-148A0A0D3DE60_BRAOL; Uncharacterized protein
STRINGBra012804.1-P1e-147(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91412238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.11e-129Dof family protein